PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100017770041
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 240aa    MW: 26611.6 Da    PI: 9.9673
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100017770041genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like962.9e-30126180155
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   k+r++W+p LH+rF++a++ LGGs++AtPk+i +lmkv+gLt+++vkSHLQkYRl
  Ote100017770041|100017770041 126 KARRCWSPHLHKRFLNALHMLGGSKVATPKQITQLMKVEGLTNDEVKSHLQKYRL 180
                                   68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.182123183IPR017930Myb domain
SuperFamilySSF466891.16E-15124181IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-26124182IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-24126181IPR006447Myb domain, plants
PfamPF002496.7E-7128179IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MASPTELTLD CKPTIESLVL KPYVEHDDAA DQETQKLQEF VARLEEEKLK INPLKPMEAL  60
RQKLQLQRLK VRASPAVEDF VSVNKSSSLS DKAEWMASAT LWNQEYEGGG GASGRENLVG  120
RKEKRKARRC WSPHLHKRFL NALHMLGGSK VATPKQITQL MKVEGLTNDE VKSHLQKYRL  180
QARIQTPNPL VVVGGIWVPP PYATAAHGGA ALCGPRAAAT RRVALPSSLD HNTCSFMQLS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008337342.19e-40PREDICTED: uncharacterized protein LOC103400468
TrEMBLA0A151SLE21e-57A0A151SLE2_CAJCA; Two-component response regulator ARR18
STRINGBGIOSGA002879-PA1e-42(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2035823